Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse BRI3-binding protein (Bri3bp)

This Recombinant Mouse BRI3-binding protein (Bri3bp) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

BRI3-binding protein, I3-binding protein

UniProt

Q8BXV2

Expression Region

1-253

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGARASQEPRTRVRAGLRVLLPVLLLALLLLALVAPGAQGARGRGAADKNSHRRATSSFS QSVSSLFGEDNVRAAQKLLSRLTERFVQGVDMFLETLWKVWMELLEVLGLDVSNLSQYFS PASVSNSPTRALVLVGVVLLAYWFLSLTLGFTFSLLHLVFGRFFWLVRVILFSMSCVYIL HKYEGEPEHAVLPLCVVVAIYFMTGPMGYWRGSPGGLCSPSVEEKLEHLENQVRLLNIRL NRVLENLDRSKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IKB alpha (Ser36) Rabbit Polyclonal Antibody (Biotin)
orb501781 100 µL

Phospho-IKB alpha (Ser36) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lactate Dehydrogenase (LDH) Human ELISA Kit
95386 96 Tests

Lactate Dehydrogenase (LDH) Human ELISA Kit

Sign In for Pricing
View Details
DnaJ (Hsp40) homolog, subfamily B, member 3
313743 100 µL

DnaJ (Hsp40) homolog, subfamily B, member 3

Sign In for Pricing
View Details
Lentiviral mouse Micu2 shRNA (UAS) - Lentiviral mouse Micu2 shRNA (UAS, GFP) plasmid
GTR15259126 1 Vial

Lentiviral mouse Micu2 shRNA (UAS) - Lentiviral mouse Micu2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
NNGH
BML-PI115-0005 5 mg

NNGH

Sign In for Pricing
View Details
Bmp2b (FITC)
556526-01 50 µg

Bmp2b (FITC)

Sign In for Pricing
View Details