Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CysZ (cysZ)

This Recombinant Protein CysZ (cysZ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Protein CysZ

UniProt

Q8FFB9

Expression Region

1-253

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSSFTSAPRSGFYYFAQGWKLVLQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM WVDCYRDKHAMWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SARS-CoV-2 ORF10 Antibody [DyLight 488]
NBP3-11939G 0.1 mL

Rabbit Polyclonal SARS-CoV-2 ORF10 Antibody [DyLight 488]

Sign In for Pricing
View Details
Nopp140 shRNA Plasmid (h)
sc-38127-SH 20 µg

Nopp140 shRNA Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human WEE1 sgRNA gene knockout kit - Lentiviral human WEE1 sgRNA gene knockout kit (25)
GTR15354278 1 Vial

Lentiviral human WEE1 sgRNA gene knockout kit - Lentiviral human WEE1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human ADCYAP1 / Pituitary adenylate cyclase-activating polypeptide Recombinant Protein
R1347h 1 Each

Human ADCYAP1 / Pituitary adenylate cyclase-activating polypeptide Recombinant Protein

Sign In for Pricing
View Details
Recombinant Chicken Homeobox protein engrailed-1(EN1)
AP74120-01 20 µg

Recombinant Chicken Homeobox protein engrailed-1(EN1)

Sign In for Pricing
View Details
Recombinant Chicken Homeobox protein engrailed-1(EN1)
AP74120-02 100 µg

Recombinant Chicken Homeobox protein engrailed-1(EN1)

Sign In for Pricing
View Details