Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CysZ (cysZ)

This Recombinant Protein CysZ (cysZ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Protein CysZ

UniProt

Q8FFB9

Expression Region

1-253

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSSFTSAPRSGFYYFAQGWKLVLQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM WVDCYRDKHAMWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (Dendritic Cell Marker) (ITGAX/1242), CF568 conjugate, 0.1mg/mL
BNC681242-500 1x 500 µL

CD11c (Dendritic Cell Marker) (ITGAX/1242), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNF185 CRISPR Knock Out 293T Cell Line (Human)
40276141 1x 10^6 Cells / 1.0 mL

RNF185 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ZBED4 3'UTR GFP Stable Cell Line
TU078704 1.0 mL

ZBED4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Quick Step Rat Interleukin 12A (IL-12A_p35) ELISA kit
QS1856Ra-01 48 Tests

Quick Step Rat Interleukin 12A (IL-12A_p35) ELISA kit

Sign In for Pricing
View Details
Quick Step Rat Interleukin 12A (IL-12A_p35) ELISA kit
QS1856Ra-02 96 Tests

Quick Step Rat Interleukin 12A (IL-12A_p35) ELISA kit

Sign In for Pricing
View Details
GPATCH4 Protein Vector (Rat) (pPB-C-His)
PV270918 500 ng

GPATCH4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details