Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CysZ (cysZ)

This Recombinant Protein CysZ (cysZ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Protein CysZ

UniProt

Q8FFB9

Expression Region

1-253

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSSFTSAPRSGFYYFAQGWKLVLQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM WVDCYRDKHAMWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLN Protein Vector (Mouse) (pPB-C-His)
PV217258 500 ng

PLN Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse visfatin Elisa Kit
EK731333 96 Well

Mouse visfatin Elisa Kit

Sign In for Pricing
View Details
IGLV1-50 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV765321 1.0 µg DNA

IGLV1-50 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant HAV VP3 Antigen
HAV-088 1 Vial

Recombinant HAV VP3 Antigen

Sign In for Pricing
View Details
MSL2 (male-Specific lethal 2 Homolog (Drosophila), FLJ10546, KIAA1585, MSL-2, MSL2L1, RNF184)
248959 100 µg

MSL2 (male-Specific lethal 2 Homolog (Drosophila), FLJ10546, KIAA1585, MSL-2, MSL2L1, RNF184)

Sign In for Pricing
View Details
Lentiviral human SLC44A3 sgRNA gene knockout kit - Lentiviral human SLC44A3 sgRNA gene knockout kit (100)
GTR15358069 1 Vial

Lentiviral human SLC44A3 sgRNA gene knockout kit - Lentiviral human SLC44A3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details