Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin domain-containing protein 1 (CLDND1)

This Recombinant Human Claudin domain-containing protein 1 (CLDND1) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Claudin domain-containing protein 1, Membrane protein GENX-3745

UniProt

Q9NY35

Expression Region

1-253

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEAD EKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFV DPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLA GLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTN RKEYTLMKAYRVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acly Mouse Gene Knockout Kit (CRISPR)
KN500720 1 Kit

Acly Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CFHL2 (CFHR2) (NM_005666) Human Over-expression Lysate
LY401729 100 µg

CFHL2 (CFHR2) (NM_005666) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS621127 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
(5S)-N-(5-Amino-1-carboxypentyl)iminodiacetic Acid
TRC-A603250-5G 5 g

(5S)-N-(5-Amino-1-carboxypentyl)iminodiacetic Acid

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human IgD Antibody[IA6-2]
E-AB-F1171Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human IgD Antibody[IA6-2]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human IgD Antibody[IA6-2]
E-AB-F1171Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human IgD Antibody[IA6-2]

Sign In for Pricing
View Details