Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin domain-containing protein 1 (CLDND1)

This Recombinant Human Claudin domain-containing protein 1 (CLDND1) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Claudin domain-containing protein 1, Membrane protein GENX-3745

UniProt

Q9NY35

Expression Region

1-253

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEAD EKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFV DPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLA GLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTN RKEYTLMKAYRVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloroaniline-15N
TRC-C364372-5MG 5 mg

2-Chloroaniline-15N

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772M1-01 20 Tests

Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772M1-02 100 Tests

Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772M1-03 2x 100 Tests

Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Plakophilin 2 (PKP2) (NM_001005242) Human Over-expression Lysate
LC423822 20 µg

Plakophilin 2 (PKP2) (NM_001005242) Human Over-expression Lysate

Sign In for Pricing
View Details
TREX1 (NM_016381) Human Over-expression Lysate
LY402546 100 µg

TREX1 (NM_016381) Human Over-expression Lysate

Sign In for Pricing
View Details