Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-3 (Tspan3)

This Recombinant Mouse Tetraspanin-3 (Tspan3) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Tetraspanin-3, Tspan-3, OSP-associated protein 1, OAP-1, Tetraspanin TM4-A, Transmembrane 4 superfamily member 8

UniProt

Q9QY33

Expression Region

1-253

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLFPAVVIIAV GALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQ KVYKTYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAK SCNGSLANPSDLYAEGCEALVVKKLQEILMHVIWAALAFAAIQLLGMLCACIVLCRRSRD PAYELLITGGTYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Bile duct
CS716559 5x 5 µm

Tissue FFPE Sections, Bile duct

Sign In for Pricing
View Details
FRG2B (NM_001080998) Human Over-expression Lysate
LC421146 20 µg

FRG2B (NM_001080998) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS501496 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
E Cadherin (CDH1) Rabbit Polyclonal Antibody
TA374521 100 µL

E Cadherin (CDH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRDM14 (NM_024504) Human Over-expression Lysate
LC402995 20 µg

PRDM14 (NM_024504) Human Over-expression Lysate

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), CF647 conjugate, 0.1mg/mL
BNC471774-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details