Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-3 (Tspan3)

This Recombinant Mouse Tetraspanin-3 (Tspan3) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Tetraspanin-3, Tspan-3, OSP-associated protein 1, OAP-1, Tetraspanin TM4-A, Transmembrane 4 superfamily member 8

UniProt

Q9QY33

Expression Region

1-253

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLFPAVVIIAV GALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQ KVYKTYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAK SCNGSLANPSDLYAEGCEALVVKKLQEILMHVIWAALAFAAIQLLGMLCACIVLCRRSRD PAYELLITGGTYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1 beta (ARNT) Human Knockdown Lysate
LY300054 100 µg

HIF1 beta (ARNT) Human Knockdown Lysate

Sign In for Pricing
View Details
FITC Anti-Human CD183/CXCR3 Antibody[G025H7]
E-AB-F1156C-01 20 Tests

FITC Anti-Human CD183/CXCR3 Antibody[G025H7]

Sign In for Pricing
View Details
FITC Anti-Human CD183/CXCR3 Antibody[G025H7]
E-AB-F1156C-02 100 Tests

FITC Anti-Human CD183/CXCR3 Antibody[G025H7]

Sign In for Pricing
View Details
FITC Anti-Human CD183/CXCR3 Antibody[G025H7]
E-AB-F1156C-03 2x 100 Tests

FITC Anti-Human CD183/CXCR3 Antibody[G025H7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Duodenum
CS805326 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details
Atad3a Rabbit Polyclonal Antibody
TA363320 100 µL

Atad3a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details