Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-3 (Tspan3)

This Recombinant Mouse Tetraspanin-3 (Tspan3) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Tetraspanin-3, Tspan-3, OSP-associated protein 1, OAP-1, Tetraspanin TM4-A, Transmembrane 4 superfamily member 8

UniProt

Q9QY33

Expression Region

1-253

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLFPAVVIIAV GALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQ KVYKTYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAK SCNGSLANPSDLYAEGCEALVVKKLQEILMHVIWAALAFAAIQLLGMLCACIVLCRRSRD PAYELLITGGTYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S,5R,6S)-5-Isopropoxy-7-oxabicyclo[4.1.0]hept-3-ene-3-carboxylic Acid Ethyl Ester
TRC-I872725-25MG 25 mg

(1S,5R,6S)-5-Isopropoxy-7-oxabicyclo[4.1.0]hept-3-ene-3-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
LAMP3 (NM_014398) Human Over-expression Lysate
LY402328 100 µg

LAMP3 (NM_014398) Human Over-expression Lysate

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF647 conjugate, 0.1mg/mL
BNC471761-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human COLCA2 activation kit by CRISPRa
GA114715 1 Kit

Human COLCA2 activation kit by CRISPRa

Sign In for Pricing
View Details
ICA1 (NM_022307) Human Over-expression Lysate
LY402921 100 µg

ICA1 (NM_022307) Human Over-expression Lysate

Sign In for Pricing
View Details
KRTAP2-4 (NM_033184) Human Over-expression Lysate
LC403233 20 µg

KRTAP2-4 (NM_033184) Human Over-expression Lysate

Sign In for Pricing
View Details