Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-11 (Tspan11)

This Recombinant Mouse Tetraspanin-11 (Tspan11) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Tetraspanin-11, Tspan-11

UniProt

Q9D1D1

Expression Region

1-253

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHCKTEQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEKSGYLSILASSTFAAS AYILIFVGGLVMTTGFLGFGAIIREQKSCLSTYFCLLLVIFLVELVAGVLAHVYYQRLSD ELKWHLNSTLTEHYGQPRAAEITASVDRLQQDFKCCGSNSSADWQHSAYILSQEALGRQV PDSCCKTVVARCGQRAHPSNIYKVEGGCMAKLEQFVADHLLLMGAVGIGVACLQICGMVL TCCLHRRLQQQFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR49 Rabbit Monoclonal Antibody
orb3072908-01 30 µL

GPR49 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GPR49 Rabbit Monoclonal Antibody
orb3072908-02 50 µL

GPR49 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GPR49 Rabbit Monoclonal Antibody
orb3072908-03 100 µL

GPR49 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GPR49 Rabbit Monoclonal Antibody
orb3072908-04 200 µL

GPR49 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
UBE3AP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K2575602 1.0 µg DNA

UBE3AP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TAF9P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2329305 3x 1.0 µg

TAF9P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details