Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat CD151 antigen (Cd151)

This Recombinant Rat CD151 antigen (Cd151) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

CD151 antigen, Platelet-endothelial tetraspan antigen 3, PETA-3, CD_antigen= CD151

UniProt

Q9QZA6

Expression Region

1-253

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT ELKENLKDTMIKRYHQSGHEGVTNAVDKLQQEFHCCGSNNSRDWRDSEWIRSGEADSRVV PDSCCKTVVTGCGKREHASNIYKVEGGCITKLESFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Flavobacterium psychrophilum UPF0747 protein FP1408 (FP1408), partial
MBS1095743 Inquire

Recombinant Flavobacterium psychrophilum UPF0747 protein FP1408 (FP1408), partial

Sign In for Pricing
View Details
Connexin 43 Rabbit Polyclonal Antibody
orb393297-01 30 µL

Connexin 43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Connexin 43 Rabbit Polyclonal Antibody
orb393297-02 50 μL

Connexin 43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Connexin 43 Rabbit Polyclonal Antibody
orb393297-03 100 µL

Connexin 43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Connexin 43 Rabbit Polyclonal Antibody
orb393297-04 200 µL

Connexin 43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Bcl2l1 shRNA (UAS) - Lentiviral mouse Bcl2l1 shRNA (UAS, iRFP) (25)
GTR15106478 1 Vial

Lentiviral mouse Bcl2l1 shRNA (UAS) - Lentiviral mouse Bcl2l1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details