Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat CD151 antigen (Cd151)

This Recombinant Rat CD151 antigen (Cd151) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

CD151 antigen, Platelet-endothelial tetraspan antigen 3, PETA-3, CD_antigen= CD151

UniProt

Q9QZA6

Expression Region

1-253

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT ELKENLKDTMIKRYHQSGHEGVTNAVDKLQQEFHCCGSNNSRDWRDSEWIRSGEADSRVV PDSCCKTVVTGCGKREHASNIYKVEGGCITKLESFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAA27 sgRNA CRISPR Lentivector set (Human)
K2474801 3x 1.0 µg

TRNAA27 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Breast invasive carcinoma of no special type with matched breast tissue array, including pathology grade, TNM, clinical stage (AJCC 7.0) and IHC marker (ER/PR/Her-2/Ki67), 1.5 mm core
BR251-L62 1 Each

Breast invasive carcinoma of no special type with matched breast tissue array, including pathology grade, TNM, clinical stage (AJCC 7.0) and IHC marker (ER/PR/Her-2/Ki67), 1.5 mm core

Sign In for Pricing
View Details
Prss33 (NM_001081399) Mouse Untagged Clone
MC214640 10 µg

Prss33 (NM_001081399) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse Prepl ELISA Kit
EF015949 96 Tests

Mouse Prepl ELISA Kit

Sign In for Pricing
View Details
CREB (cAMP Response Element Binding Protein) (PE) discontinued
C7915-PE 100 µL

CREB (cAMP Response Element Binding Protein) (PE) discontinued

Sign In for Pricing
View Details
Mouse Heat Shock 70kDa Protein 5 (HSPA5) ELISA Kit
MBS164449-01 48 Well

Mouse Heat Shock 70kDa Protein 5 (HSPA5) ELISA Kit

Sign In for Pricing
View Details