Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat CD151 antigen (Cd151)

This Recombinant Rat CD151 antigen (Cd151) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

CD151 antigen, Platelet-endothelial tetraspan antigen 3, PETA-3, CD_antigen= CD151

UniProt

Q9QZA6

Expression Region

1-253

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT ELKENLKDTMIKRYHQSGHEGVTNAVDKLQQEFHCCGSNNSRDWRDSEWIRSGEADSRVV PDSCCKTVVTGCGKREHASNIYKVEGGCITKLESFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D10C antibody - N-terminal region (ARP55894_P050)
ARP55894_P050 100 µL

TBC1D10C antibody - N-terminal region (ARP55894_P050)

Sign In for Pricing
View Details
TFPI Recombinant Protein
OPCD07354-10UG 10 µg

TFPI Recombinant Protein

Sign In for Pricing
View Details
STK33 (G-11) AC
sc-376498 AC 500 µg/mL - 25% ag

STK33 (G-11) AC

Sign In for Pricing
View Details
Human Kinesin-like protein KIF7, KIF7 ELISA Kit
MBS9328047-01 48 Well

Human Kinesin-like protein KIF7, KIF7 ELISA Kit

Sign In for Pricing
View Details
Human Kinesin-like protein KIF7, KIF7 ELISA Kit
MBS9328047-02 96 Well

Human Kinesin-like protein KIF7, KIF7 ELISA Kit

Sign In for Pricing
View Details
Human Kinesin-like protein KIF7, KIF7 ELISA Kit
MBS9328047-03 5x 96 Well

Human Kinesin-like protein KIF7, KIF7 ELISA Kit

Sign In for Pricing
View Details