Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-3 (TSPAN3)

This Recombinant Human Tetraspanin-3 (TSPAN3) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Tetraspanin-3, Tspan-3, Tetraspanin TM4-A, Transmembrane 4 superfamily member 8

UniProt

O60637

Expression Region

1-253

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAV GALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQ KVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAS NCNGSLAHPSDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRD PAYELLITGGTYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS802544 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Diisopentyl Oxalate
TRC-D455248-5G 5 g

Diisopentyl Oxalate

Sign In for Pricing
View Details
CD109 Human Gene Knockout Kit (CRISPR)
KN213359LP 1 Kit

CD109 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPIN1 Antibody
8C11983-AAT 50 µg

SPIN1 Antibody

Sign In for Pricing
View Details
PIP5KI gamma (PIP5K1C) Rabbit Polyclonal Antibody
TA366934 100 µL

PIP5KI gamma (PIP5K1C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Top2a Mouse Gene Knockout Kit (CRISPR)
KN518059 1 Kit

Top2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details