Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-3 (TSPAN3)

This Recombinant Human Tetraspanin-3 (TSPAN3) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Tetraspanin-3, Tspan-3, Tetraspanin TM4-A, Transmembrane 4 superfamily member 8

UniProt

O60637

Expression Region

1-253

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAV GALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQ KVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAS NCNGSLAHPSDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRD PAYELLITGGTYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDX1 Polyclonal Antibody
E-AB-15824-01 20 µL

PDX1 Polyclonal Antibody

Sign In for Pricing
View Details
PDX1 Polyclonal Antibody
E-AB-15824-02 60 µL

PDX1 Polyclonal Antibody

Sign In for Pricing
View Details
PDX1 Polyclonal Antibody
E-AB-15824-03 120 µL

PDX1 Polyclonal Antibody

Sign In for Pricing
View Details
PDX1 Polyclonal Antibody
E-AB-15824-04 200 µL

PDX1 Polyclonal Antibody

Sign In for Pricing
View Details
NRG1 (NM_001159996) Human Over-expression Lysate
LC431269 20 µg

NRG1 (NM_001159996) Human Over-expression Lysate

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF568 conjugate, 0.1mg/mL
BNC682641-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2641), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details