Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorocebus aethiops CD151 antigen (CD151)

This Recombinant Chlorocebus aethiops CD151 antigen (CD151) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

CD151 antigen, Platelet-endothelial tetraspan antigen 3, PETA-3, CD_antigen= CD151

UniProt

P61170

Expression Region

1-253

Origin

Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGAVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGVLAYVYYQQLNT ELKENLKDTMAKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRLREARGRVV PDSCCKTVVAGCGQRDHAFNIYKVEGGFITKLETFIQEHLRVIGAVGTGIACVQVFGMIF TCCLYRSLKLEHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BRD4 Antibody (CL1115)
NBP2-52958-25ul 25 µL

Mouse Monoclonal BRD4 Antibody (CL1115)

Sign In for Pricing
View Details
RsrIM (Biotin)
575321-01 50 µL

RsrIM (Biotin)

Sign In for Pricing
View Details
RsrIM (Biotin)
575321-02 100 µL

RsrIM (Biotin)

Sign In for Pricing
View Details
FAM171B Recombinant Protein (Human)
RP011440 100 µg

FAM171B Recombinant Protein (Human)

Sign In for Pricing
View Details
1-Bromo-2-naphthol
sc-237481A 100 g

1-Bromo-2-naphthol

Sign In for Pricing
View Details
TruStrip WBV Zika Virus Proteins (Env, NS1, Cap, prM) Explorer Western Blot Validation Strips (10/pk); Ab Type: Monkey IgM
WBZEX1025-10 1 Pk

TruStrip WBV Zika Virus Proteins (Env, NS1, Cap, prM) Explorer Western Blot Validation Strips (10/pk); Ab Type: Monkey IgM

Sign In for Pricing
View Details