Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorocebus aethiops CD151 antigen (CD151)

This Recombinant Chlorocebus aethiops CD151 antigen (CD151) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

CD151 antigen, Platelet-endothelial tetraspan antigen 3, PETA-3, CD_antigen= CD151

UniProt

P61170

Expression Region

1-253

Origin

Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGAVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGVLAYVYYQQLNT ELKENLKDTMAKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRLREARGRVV PDSCCKTVVAGCGQRDHAFNIYKVEGGFITKLETFIQEHLRVIGAVGTGIACVQVFGMIF TCCLYRSLKLEHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMED2, NT (TMED2, RNP24, Transmembrane emp24 domain-containing protein 2, Membrane protein p24A, p24, p24 family protein beta-1) (AP) discontinued
042924-AP 200 µL

TMED2, NT (TMED2, RNP24, Transmembrane emp24 domain-containing protein 2, Membrane protein p24A, p24, p24 family protein beta-1) (AP) discontinued

Sign In for Pricing
View Details
CD3 (MaxLight 650)
214654-ML650 100 µL

CD3 (MaxLight 650)

Sign In for Pricing
View Details
FBXL14 CRISPRa sgRNA lentivector (set of three targets)(Human)
20291121 3x 1.0µg DNA

FBXL14 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
KIAA0090 Lentiviral Activation Particles (h)
sc-418313-LAC 200 µL

KIAA0090 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
ERCC1 antibody
FNab02832 100 µg

ERCC1 antibody

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Dephospho-CoA kinase (coaE)
MBS1425832-01 0.02 mg (E-Coli)

Recombinant Rhodoferax ferrireducens Dephospho-CoA kinase (coaE)

Sign In for Pricing
View Details