Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme ATP synthase subunit a (atpB)

This Recombinant Nostoc punctiforme ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B2J053

Expression Region

1-253

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQMLSVLNAFNSFPLAELEVGHHFYWQLGNLKIHGQVFLTSWFVISILVVASIAATRNAQ RIPKGIQNLMEYALEFIRDLAKNQLGEKEYRPWVPFIGTLFLFIFVSNWSGALIPWKLIK LPSGELAAPTNDINTTVALALLTSLAYFYAGFSKRGLGYFKKYIEPTPVLLPIAILEDFT KPLSLSFRLFGNILADELVVAVLVLLVPLFVPLPVMALGLFTSAIQALVFATLAGAYIHE AMEGHGGEEHEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lynestrenol 5mg
A17461-5 5 mg

Lynestrenol 5mg

Sign In for Pricing
View Details
SEZ6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2129508 1.0 µg DNA

SEZ6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PURB Rabbit Polyclonal Antibody (Cy5.5)
orb1079417 100 µL

PURB Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
CNTN2 Protein Vector (Mouse) (pPM-C-HA)
PV166876 500 ng

CNTN2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ARHGAP30 Antibody (C-term)
MBS9205040-01 0.08 mL

ARHGAP30 Antibody (C-term)

Sign In for Pricing
View Details
ARHGAP30 Antibody (C-term)
MBS9205040-02 0.4 mL

ARHGAP30 Antibody (C-term)

Sign In for Pricing
View Details