Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Reaction center protein L chain (pufL)

This Recombinant Reaction center protein L chain (pufL) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Reaction center protein L chain, Photosynthetic reaction center L subunit

UniProt

O66141

Expression Region

1-254

Origin

Acidiphilium organovorum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YWVGPFYVGFFGVTAAFFIMLGTALIIWGAALGPTWNIWQISIAPPDLSYGLGLAPLAKG GLWQIITVCAIGAFGSWALREVEISRKLGIGLHVPAAFSVAIFAYVTLEVIRPLLMGAWG NGFPYGIMSHLDWVSNTGYAYLNFEYNPMHMVAVTLFFTTTLALALHGSLVLAAINPPAG ETVKFAEHEDTFFRDFIGYSIGTLGIHRLGLFLALGAGFASATCILLSGPFWTQGWPSWW GWWLHLPIWQFGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-500 1x 500 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-100 1x 100 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-100 1x 100 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (2755-8), CF405S conjugate, 0.1mg/mL
BNC040091-100 1x 100 µL

Fibronectin (2755-8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details