Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein orai-2 (ORAI2)

This Recombinant Human Protein orai-2 (ORAI2) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Protein orai-2, CAP-binding protein complex-interacting protein 2, Transmembrane protein 142B

UniProt

Q96SN7

Expression Region

1-254

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAKL KASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTCILP NVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARR QPGPPPGPGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEELHKL KVQLDGHERSLQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sid-2 Antibody
orb802305 2 mg

Sid-2 Antibody

Sign In for Pricing
View Details
C4orf48 Lentiviral Activation Particles (h)
sc-415967-LAC 200 µL

C4orf48 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
CHMP1A Polyclonal Antibody
A73060-100 100 µL

CHMP1A Polyclonal Antibody

Sign In for Pricing
View Details
2-Propylpiperidine Hydrobromide
P235405 10 mg

2-Propylpiperidine Hydrobromide

Sign In for Pricing
View Details
BAIAP2 Antibody
A53613-100UL 100 µL

BAIAP2 Antibody

Sign In for Pricing
View Details
NNMT Conjugated Antibody
orb1617208 100 µL

NNMT Conjugated Antibody

Sign In for Pricing
View Details