Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (Srd5a2)

This Recombinant Mouse 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (Srd5a2) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

3-oxo-5-alpha-steroid 4-dehydrogenase 2, EC= 1.3.99.5, 5 alpha-SR2, SR type 2, Steroid 5-alpha-reductase 2, S5AR 2

UniProt

Q99N99

Expression Region

1-254

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIVCHQVPVLAGSATLATMGTLILCFGKPASYGKHSESVSSGVPLLPARIAWFLQELPS FVVSVGMLAWQPRSLFGPPGNVLLGLFSAHYFHRTFIYSLLTRGRPLSAVIFLKATAFCI GNGLLQAYYLVYCAEYPEEWYTDMRFSVGVFFFILGMGINIHSDCMLRQLRKPGEVIYRI PQGGLFTYVSGANFLGEIIEWMGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFK DYPKSRKALIPFIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EPT1 (SELENOI) activation kit by CRISPRa
GA113904 1 Kit

Human EPT1 (SELENOI) activation kit by CRISPRa

Sign In for Pricing
View Details
(5E)-5-(3-Bromopropylidene)-5,11-dihydro-10H-dibenzo[a,d]cyclohepten-10-one
TRC-B471360-25MG 25 mg

(5E)-5-(3-Bromopropylidene)-5,11-dihydro-10H-dibenzo[a,d]cyclohepten-10-one

Sign In for Pricing
View Details
NRF1 (NRF1/2608), CF568 conjugate, 0.1mg/mL
BNC682608-500 1x 500 µL

NRF1 (NRF1/2608), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nav1.5 (SCN5A) Mouse Monoclonal Antibody [Clone ID: OTI5E9]
TA815385S 30 µL

Nav1.5 (SCN5A) Mouse Monoclonal Antibody [Clone ID: OTI5E9]

Sign In for Pricing
View Details
CD1a Rabbit Polyclonal Antibody
ER1902-73 100 µL

CD1a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYB5 Antibody
8C13038-AAT 50 µg

CYB5 Antibody

Sign In for Pricing
View Details