Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (Srd5a2)

This Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (Srd5a2) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

3-oxo-5-alpha-steroid 4-dehydrogenase 2, EC= 1.3.99.5, 5 alpha-SR2, SR type 2, Steroid 5-alpha-reductase 2, S5AR 2

UniProt

P31214

Expression Region

1-254

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIVCHQVPVLAGSATLATMGTLILCLGKPASYGKHTESVSSGVPFLPARIAWFLQELPS FVVSVGMLAWQPRSLFGPPGNVLLALFSAHYFHRTFIYSLLTRGRPFPAVLFLRATAFCI GNGLLQAYYLVYCAEYPEEWYTDVRFSFGVFLFILGMGINIHSDYTLRQLRKPGEVIYRI PRGGLFTYVSGANFLGEIIEWIGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFK DYPKSRKALIPFIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-100 1x 100 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2966), CF594 conjugate, 0.1mg/mL
BNC942966-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2966), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL
BNC680917-100 1x 100 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF568 conjugate, 0.1mg/mL
BNC681777-500 1x 500 µL

Prostate Specific Antigen (PSA) (3E6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details