Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqgB (yqgB)

This Recombinant Bacillus subtilis Uncharacterized protein yqgB (yqgB) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized protein yqgB

UniProt

P54485

Expression Region

1-255

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVFQLFIKSTYSPRDIAKTRFQGIGKAILYVFLLSVLFAIPTAYYVSTGTVKSMNGFKT VLNKDFPDFTISNGKLQTDEKKATESQANGFVIVFDPTDSYGTEQIEAKQNAIGILQNKF VLAIDGQAQEMSYSMMPSELQKKDVIAGLNQNKAMIVTVLSALIFLVTAAGKFIEVSFLA LIGLIIKNSQKKHLSYHQLWKLSAYSITLSTVFFTIMRALEATVPSEFLLNWFVNFVILF LVLKEIPSKKVINKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM16K (ANO10) Human Gene Knockout Kit (CRISPR)
KN415283 1 Kit

TMEM16K (ANO10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Meninges
CS712486 5x 5 µm

Tissue FFPE Sections, Meninges

Sign In for Pricing
View Details
PAF1 Rabbit Polyclonal Antibody
TA370388 100 µL

PAF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Z-[4-(1,2-Diphenyl-1-butenyl)phenoxy]acetic Acid
TRC-D489468-500MG 500 mg

Z-[4-(1,2-Diphenyl-1-butenyl)phenoxy]acetic Acid

Sign In for Pricing
View Details
MAPKAP Kinase 2 (MAPKAPK2) (NM_004759) Human Recombinant Protein
TP320487 20 µg

MAPKAP Kinase 2 (MAPKAPK2) (NM_004759) Human Recombinant Protein

Sign In for Pricing
View Details
c-Jun (JUN) non phospho Ser63 Rabbit Polyclonal Antibody
AP02545PU-N 100 µL

c-Jun (JUN) non phospho Ser63 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details