Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqgB (yqgB)

This Recombinant Bacillus subtilis Uncharacterized protein yqgB (yqgB) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized protein yqgB

UniProt

P54485

Expression Region

1-255

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVFQLFIKSTYSPRDIAKTRFQGIGKAILYVFLLSVLFAIPTAYYVSTGTVKSMNGFKT VLNKDFPDFTISNGKLQTDEKKATESQANGFVIVFDPTDSYGTEQIEAKQNAIGILQNKF VLAIDGQAQEMSYSMMPSELQKKDVIAGLNQNKAMIVTVLSALIFLVTAAGKFIEVSFLA LIGLIIKNSQKKHLSYHQLWKLSAYSITLSTVFFTIMRALEATVPSEFLLNWFVNFVILF LVLKEIPSKKVINKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VDAC1 Polyclonal Antibody
E-AB-52417-01 20 µL

VDAC1 Polyclonal Antibody

Sign In for Pricing
View Details
VDAC1 Polyclonal Antibody
E-AB-52417-02 60 µL

VDAC1 Polyclonal Antibody

Sign In for Pricing
View Details
VDAC1 Polyclonal Antibody
E-AB-52417-03 120 µL

VDAC1 Polyclonal Antibody

Sign In for Pricing
View Details
VDAC1 Polyclonal Antibody
E-AB-52417-04 200 µL

VDAC1 Polyclonal Antibody

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF640R conjugate, 0.1mg/mL
BNC402937-100 1x 100 µL

CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EnzyChrom™ NAD/NADH Assay Kit
E2ND-100 100 Tests

EnzyChrom™ NAD/NADH Assay Kit

Sign In for Pricing
View Details