Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio harveyi ATP synthase subunit a 2 (atpB2)

This Recombinant Vibrio harveyi ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

A7N2U2

Expression Region

1-255

Origin

Vibrio harveyi (strain ATCC BAA-1116 / BB120)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVQSAHEYIEHHLTFLTAGDGWFGINLDSMIMVWLTGLVFILSFRYAVTKGTKGVPGR FQCLIEIIFEFVDDIVKEIFQAKDKLIGPLALTIFVWVLLMNAVDLLPIDLIPALTSAVG VEHFRDLPSADINITMSMALGVFILVLGYTFKNKGVKGFIKELTTQPFSHPLLYPVNLVL ELVTLISKPISLGLRLFGNMYAGEMIFILIALMPWWMQWALSVPWALFHILIVVLQAFIF MVLTVVYLGMAVEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF594 conjugate, 0.1mg/mL
BNC941541-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (FXP3/197), CF594 conjugate, 0.1mg/mL
BNC940197-500 1x 500 µL

FOXP3 (FXP3/197), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF405S conjugate, 0.1mg/mL
BNC042590-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details