Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 41A-B (tmem41ab)

This Recombinant Danio rerio Transmembrane protein 41A-B (tmem41ab) spans the amino acid sequence from region 24-278.

Product Specifications

Product Name Alternative

Transmembrane protein 41A-B

UniProt

Q6NV38

Expression Region

24-278

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FLPPGPRAIRVHDTGPEHTDDEPEEKVLRLKFPSDLEELRELAELLKFYKTEHTGYVFIL FCSAYLYKQSFAIPGSSFLNMLSGALFGPLHGLIIACTLTTVGSTNCYLLSRTFGKRHIV RLFPEKVAMLQRMVEENRSSLFFFLLFLRFFPMTPNWFLNVTSPILNIPIPIFFFSILIG LIPYNFICVHTGAVLSEINSLDDIFSWFTLLQLLLIACVALLPGALIRRYSKDHLKLHGL EPNGHQKILNDRKTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-500 1x 500 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2952), CF740 conjugate, 0.1mg/mL
BNC742952-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2952), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF568 conjugate, 0.1mg/mL
BNC682041-100 1x 100 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF488A conjugate, 0.1mg/mL
BNC880417-500 1x 500 µL

Fascin-1 (FSCN1/417), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details