Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yjjP (yjjP)

This Recombinant Inner membrane protein yjjP (yjjP) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Inner membrane protein yjjP

UniProt

P0ADD6

Expression Region

1-256

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTEQQRAVTRLCIQCGLFLLQHGAESALVDELSSRLGRALGMDSVESSISSNAIVLTTI KDGQCLTSTRKNHDRGINMHVVTEVQHIVILAEHHLLDYKGVEKRFSQIQPLRYPRWLVA LMVGLSCACFCKLNNGGWDGAVITFFASTTAMYIRQLLAQRHLHPQINFCLTAFAATTIS GLLLQLPTFSNTPTIAMAASVLLLVPGFPLINAVADMFKGHINTGLARWAIASLLTLATC VGVVMALTIWGLRGWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat EpCAM/TROP-1 Protein (His Tag)
PKSR030246 100 µg

Recombinant Rat EpCAM/TROP-1 Protein (His Tag)

Sign In for Pricing
View Details
Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit
E-MSEL-M0083-01 24 Tests

Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit
E-MSEL-M0083-02 48 Tests

Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit
E-MSEL-M0083-03 96 Tests

Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit

Sign In for Pricing
View Details
Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-,  5nm
GP-2301-5 1 mL

Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-, 5nm

Sign In for Pricing
View Details
rac-1-Linoleoyl-2-linolenoyl-3-chloropropanediol-d5
TRC-L468082-1MG 1 mg

rac-1-Linoleoyl-2-linolenoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details