Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Protein YIPF5 (yipf5)

This Recombinant Xenopus tropicalis Protein YIPF5 (yipf5) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Protein YIPF5, YIP1 family member 5

UniProt

Q66KA5

Expression Region

1-256

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNFDNFNTDFYQTSYSIDDQSQGYNYNAGGAQHSKQYAYDPYSQQGGFIPPEMMNQQQP YTGQIYQPTQTYTPAATDSVYGSTFDDEPPLLEELGINFDHIWQKTLTVLHPLKVADGNI MNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMYCLLNLMSMTGVSFGCVS SVLGYCLLPMIILSSFAVIFSLQGILGIVLAALIIGWCSFSASKIFISALAMDGQQVLVA YPCALLYGVFALISVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

R-Benzbromarone
TRC-B185210-100MG 100 mg

R-Benzbromarone

Sign In for Pricing
View Details
IL19 (NM_013371) Human Recombinant Protein
TP312571L 1 mg

IL19 (NM_013371) Human Recombinant Protein

Sign In for Pricing
View Details
ULK2 Human Gene Knockout Kit (CRISPR)
KN206010LP 1 Kit

ULK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HDAC10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D4]
TA500754BM 100 µL

HDAC10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D4]

Sign In for Pricing
View Details
OR1D2 (NM_002548) Human Over-expression Lysate
LC419254 20 µg

OR1D2 (NM_002548) Human Over-expression Lysate

Sign In for Pricing
View Details
Dnmt3b Rabbit Polyclonal Antibody
ER1802-55 100 µL

Dnmt3b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details