Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-32 (Tspan32)

This Recombinant Mouse Tetraspanin-32 (Tspan32) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Tetraspanin-32, Tspan-32, AML1-regulated transmembrane protein 1, Protein Phemx

UniProt

Q9JHH2

Expression Region

1-256

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHWNRIKIAKCQILITNFLVLLLGLSMATMVVVIHFGDHFTVIGHASLERNPYETLRYW AFYVGISLAGLLSLGAALSTIATVREAHGLMAAGFLCFALSFCILVQVAFWRFYNPTQVE DAVLDTYDFVYDQAMKSPSSNWWQELAVIQDTFLCCGKKSPFGLLVSTGAIMCQGREAMR EDCLQSIRNVLWTHYSIASILTCTSLALTVYAMMLCAFLWFAIHSYHGLDRKGRYSLTPP RSHGFQTQEPSLFRWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL-18/IL-1F4 Antibody (169) [CoraFluor 1]
NBP2-90395CL1 0.1 mL

Rabbit Monoclonal IL-18/IL-1F4 Antibody (169) [CoraFluor 1]

Sign In for Pricing
View Details
Vmn1r83 Recombinant Protein (Mouse)
RP184436 100 µg

Vmn1r83 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
P-cadherin Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-1159R-PerCP-Cy5.5 100 µL

P-cadherin Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Human Infectious Bronchitis Antibody, IBV ELISA KIT
ED0121Hu-01 96 Well

Human Infectious Bronchitis Antibody, IBV ELISA KIT

Sign In for Pricing
View Details
Human Infectious Bronchitis Antibody, IBV ELISA KIT
ED0121Hu-02 5x 96 Tests

Human Infectious Bronchitis Antibody, IBV ELISA KIT

Sign In for Pricing
View Details
Human Infectious Bronchitis Antibody, IBV ELISA KIT
ED0121Hu-03 10x 96 Tests

Human Infectious Bronchitis Antibody, IBV ELISA KIT

Sign In for Pricing
View Details