Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-32 (Tspan32)

This Recombinant Mouse Tetraspanin-32 (Tspan32) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Tetraspanin-32, Tspan-32, AML1-regulated transmembrane protein 1, Protein Phemx

UniProt

Q9JHH2

Expression Region

1-256

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHWNRIKIAKCQILITNFLVLLLGLSMATMVVVIHFGDHFTVIGHASLERNPYETLRYW AFYVGISLAGLLSLGAALSTIATVREAHGLMAAGFLCFALSFCILVQVAFWRFYNPTQVE DAVLDTYDFVYDQAMKSPSSNWWQELAVIQDTFLCCGKKSPFGLLVSTGAIMCQGREAMR EDCLQSIRNVLWTHYSIASILTCTSLALTVYAMMLCAFLWFAIHSYHGLDRKGRYSLTPP RSHGFQTQEPSLFRWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hexyl-2-mercapto-6-methylpyrimidin-4 (3H) -one
OR1057780-01 100 mg

5-Hexyl-2-mercapto-6-methylpyrimidin-4 (3H) -one

Sign In for Pricing
View Details
5-Hexyl-2-mercapto-6-methylpyrimidin-4 (3H) -one
OR1057780-02 250 mg

5-Hexyl-2-mercapto-6-methylpyrimidin-4 (3H) -one

Sign In for Pricing
View Details
5-Hexyl-2-mercapto-6-methylpyrimidin-4 (3H) -one
OR1057780-03 1 g

5-Hexyl-2-mercapto-6-methylpyrimidin-4 (3H) -one

Sign In for Pricing
View Details
Human IDH1 AssayLite™ Antibody (FITC Conjugate)
32542-05141 2x 75 µg

Human IDH1 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Rheostats, Sliding Contact, Open Type, Single Tube
1090980/4C 1 Each

Rheostats, Sliding Contact, Open Type, Single Tube

Sign In for Pricing
View Details
Mouse Monoclonal GluR2 Antibody (3A11) [Alexa Fluor 700]
NBP2-29731AF700 0.1 mL

Mouse Monoclonal GluR2 Antibody (3A11) [Alexa Fluor 700]

Sign In for Pricing
View Details