Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-32 (Tspan32)

This Recombinant Mouse Tetraspanin-32 (Tspan32) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Tetraspanin-32, Tspan-32, AML1-regulated transmembrane protein 1, Protein Phemx

UniProt

Q9JHH2

Expression Region

1-256

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHWNRIKIAKCQILITNFLVLLLGLSMATMVVVIHFGDHFTVIGHASLERNPYETLRYW AFYVGISLAGLLSLGAALSTIATVREAHGLMAAGFLCFALSFCILVQVAFWRFYNPTQVE DAVLDTYDFVYDQAMKSPSSNWWQELAVIQDTFLCCGKKSPFGLLVSTGAIMCQGREAMR EDCLQSIRNVLWTHYSIASILTCTSLALTVYAMMLCAFLWFAIHSYHGLDRKGRYSLTPP RSHGFQTQEPSLFRWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti KDM6A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 200ul
IRBAMLKDM6AAP874200UL 200 µL

Rabbit Anti KDM6A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 200ul

Sign In for Pricing
View Details
Dnajb12 Rabbit Polyclonal Antibody
TA342339 100 µL

Dnajb12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stimulated by retinoic Acid gene 6 protein homolog (STRA6) Rat ELISA Kit
H3318 96 Tests

Stimulated by retinoic Acid gene 6 protein homolog (STRA6) Rat ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin-like protein KIF17, KIF17 ELISA Kit
MBS9331375-01 48 Well

Mouse Kinesin-like protein KIF17, KIF17 ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin-like protein KIF17, KIF17 ELISA Kit
MBS9331375-02 96 Well

Mouse Kinesin-like protein KIF17, KIF17 ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin-like protein KIF17, KIF17 ELISA Kit
MBS9331375-03 5x 96 Well

Mouse Kinesin-like protein KIF17, KIF17 ELISA Kit

Sign In for Pricing
View Details