Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Membrane protein insertase MisCB (misCB)

This Recombinant Bacillus subtilis Membrane protein insertase MisCB (misCB) spans the amino acid sequence from region 19-275.

Product Specifications

Product Name Alternative

Membrane protein insertase MisCB, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

P54544

Expression Region

19-275

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSGNAAFAATNQVGGLSNVGFFHDYLIEPFSALLKGVAGLFHGEYGLSIILVTIIVRIVV LPLFVNQFKKQRIFQEKMAVIKPQVDSIQVKLKKTKDPEKQKELQMEMMKLYQEHNINPL AMGCLPMLIQSPIMIGLYYAIRSTPEIASHSFLWFSLGQSDILMSLSAGIMYFVQAYIAQ KLSAKYSAVPQNPAAQQSAKLMVFIFPVMMTIFSLNVPAALPLYWFTSGLFLTVQNIVLQ MTHHKSKKTAALTESVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGN2P14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV728213 1.0 µg DNA

HMGN2P14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
P2RY14 Adenovirus (Mouse)
35870054 1.0 mL

P2RY14 Adenovirus (Mouse)

Sign In for Pricing
View Details
Human TFRC qPCR Primer Pair
QH00073S 200 Tests

Human TFRC qPCR Primer Pair

Sign In for Pricing
View Details
TMED1 Protein (C-His, Human)
P518840 100 µg

TMED1 Protein (C-His, Human)

Sign In for Pricing
View Details
3-fluoro-4- (1H-imidazol-1-yl) benzaldehyde
sc-346914 1 g

3-fluoro-4- (1H-imidazol-1-yl) benzaldehyde

Sign In for Pricing
View Details
Human hsa-miR-412-3p miRNA Antagomir
abx885473-01 10 nmol

Human hsa-miR-412-3p miRNA Antagomir

Sign In for Pricing
View Details