Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halorubrum lacusprofundi Cobalamin synthase (cobS)

This Recombinant Halorubrum lacusprofundi Cobalamin synthase (cobS) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B9LRL5

Expression Region

1-257

Origin

Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILTALRGALGFLTRIPVGRDEAAWAAFARSPWTFPVVGYLVGGLVALSLFVPAPAPTVA LAFVLAVYAVTGIGHLDGVADIGDAAAVHGDREERRRVLKDSALGVGGTVALALVVLGLA TAALGLVEVAATAGDGGPLPPVIGIVVAAEVGAKAATATLVCVGDAPHEGLGSALTGESS PGATLSVFALAAPAALLTWPQVLPGLAALLVALATAALVARWSRRRLGGVSGDVLGATTE LARVAALHAGVIAWTRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Avidin Texas Red
BA-612-5 5 mg

Avidin Texas Red

Sign In for Pricing
View Details
RNase L (RNASEL) Human Gene Knockout Kit (CRISPR)
KN214849RB 1 Kit

RNase L (RNASEL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3,3'-(1,4-Phenylene)bis[5,6-diphenyl-1,2,4-triazine]
TRC-P054990-1G 1 g

3,3'-(1,4-Phenylene)bis[5,6-diphenyl-1,2,4-triazine]

Sign In for Pricing
View Details
G3BP (G3BP1) Human Gene Knockout Kit (CRISPR)
KN402692 1 Kit

G3BP (G3BP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 S protein RBD (K417T), His Tag (MALS verified)
SPD-C52Ht-100ug 100 µg

SARS-CoV-2 S protein RBD (K417T), His Tag (MALS verified)

Sign In for Pricing
View Details
DHLAG (CD74) (NM_004355) Human Over-expression Lysate
LY429196 100 µg

DHLAG (CD74) (NM_004355) Human Over-expression Lysate

Sign In for Pricing
View Details