Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Protein YIPF5 (YIPF5)

This Recombinant Macaca fascicularis Protein YIPF5 (YIPF5) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein YIPF5, YIP1 family member 5

UniProt

Q4R5M4

Expression Region

1-257

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQ PYTGQIYQPTQAYTPASPQPFYGNSFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Grb7 ELISA Kit
ELI-47995r 96 Tests

Rat Grb7 ELISA Kit

Sign In for Pricing
View Details
TRNAP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV753211 1.0 µg DNA

TRNAP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
BEGAIN (NM_020836) Human Over-expression Lysate
LC412260 20 µg

BEGAIN (NM_020836) Human Over-expression Lysate

Sign In for Pricing
View Details
Anisaldehyde 98% Extrapure
27200500 500 mL

Anisaldehyde 98% Extrapure

Sign In for Pricing
View Details
Cytochrome P450 24A1 Antibody, mAb, Rabbit
A04953-50 50 µL

Cytochrome P450 24A1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Keratin (Type I cuticular Ha2 (KRT32) Mouse ELISA Kit
E4954 96 Tests

Keratin (Type I cuticular Ha2 (KRT32) Mouse ELISA Kit

Sign In for Pricing
View Details