Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Protein YIPF5 (YIPF5)

This Recombinant Macaca fascicularis Protein YIPF5 (YIPF5) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein YIPF5, YIP1 family member 5

UniProt

Q4R5M4

Expression Region

1-257

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQ PYTGQIYQPTQAYTPASPQPFYGNSFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Peroxiredoxin 4 (PRDX4) ELISA Kit
YLA3518HU-01 48 Tests

Human Peroxiredoxin 4 (PRDX4) ELISA Kit

Sign In for Pricing
View Details
Human Peroxiredoxin 4 (PRDX4) ELISA Kit
YLA3518HU-02 96 Tests

Human Peroxiredoxin 4 (PRDX4) ELISA Kit

Sign In for Pricing
View Details
MAPT Recombinant Monoclonal Antibody [4A1]
A74287-100 100 µL

MAPT Recombinant Monoclonal Antibody [4A1]

Sign In for Pricing
View Details
Anti-CD1d Antibody
CPA4885-01 30 µL

Anti-CD1d Antibody

Sign In for Pricing
View Details
Anti-CD1d Antibody
CPA4885-02 50 μL

Anti-CD1d Antibody

Sign In for Pricing
View Details
Anti-CD1d Antibody
CPA4885-03 100 µL

Anti-CD1d Antibody

Sign In for Pricing
View Details