Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Protein YIPF5 (YIPF5)

This Recombinant Macaca fascicularis Protein YIPF5 (YIPF5) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein YIPF5, YIP1 family member 5

UniProt

Q4R5M4

Expression Region

1-257

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQ PYTGQIYQPTQAYTPASPQPFYGNSFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRC, ID (HRC, HCP, Sarcoplasmic reticulum histidine-rich calcium-binding protein) (AP)
MBS6308353-01 0.2 mL

HRC, ID (HRC, HCP, Sarcoplasmic reticulum histidine-rich calcium-binding protein) (AP)

Sign In for Pricing
View Details
HRC, ID (HRC, HCP, Sarcoplasmic reticulum histidine-rich calcium-binding protein) (AP)
MBS6308353-02 5x 0.2 mL

HRC, ID (HRC, HCP, Sarcoplasmic reticulum histidine-rich calcium-binding protein) (AP)

Sign In for Pricing
View Details
PDSS2 Human shRNA Plasmid Kit (Locus ID 57107)
TL302559 1 Kit

PDSS2 Human shRNA Plasmid Kit (Locus ID 57107)

Sign In for Pricing
View Details
ASH2L Antibody, FITC conjugated
CSB-PA883363LC01HU-01 50 µg

ASH2L Antibody, FITC conjugated

Sign In for Pricing
View Details
ASH2L Antibody, FITC conjugated
CSB-PA883363LC01HU-02 100 µg

ASH2L Antibody, FITC conjugated

Sign In for Pricing
View Details
Gtf2h1 3'UTR GFP Stable Cell Line
TU255543 1.0 mL

Gtf2h1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details