Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein YIPF5 (YIPF5)

This Recombinant Bovine Protein YIPF5 (YIPF5) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein YIPF5, YIP1 family member 5

UniProt

Q5E9E8

Expression Region

1-257

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFDNLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSHQGRFVPADMMQPQQ PYTGQIFQPTQTYTPTTPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish PDGFRB Antibody Picoband®
AZD9MNA7 100 µg/Vial

Anti-Zebrafish PDGFRB Antibody Picoband®

Sign In for Pricing
View Details
Parathyroid Hormone 1-34, Human 100mg
A12790-100 100 mg

Parathyroid Hormone 1-34, Human 100mg

Sign In for Pricing
View Details
Dectin 1 (CLEC7A) (NM_197954) Human Tagged ORF Clone
RC222007 10 µg

Dectin 1 (CLEC7A) (NM_197954) Human Tagged ORF Clone

Sign In for Pricing
View Details
PIGK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV655730 1.0 µg DNA

PIGK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
6- (2-carboxy-6-hydroxy-4-methylphenoxy) -3- (1-hydroxy-3-methylbutyl) -2-methoxybenzoic acid
orb3171813-01 1 mg

6- (2-carboxy-6-hydroxy-4-methylphenoxy) -3- (1-hydroxy-3-methylbutyl) -2-methoxybenzoic acid

Sign In for Pricing
View Details
6- (2-carboxy-6-hydroxy-4-methylphenoxy) -3- (1-hydroxy-3-methylbutyl) -2-methoxybenzoic acid
orb3171813-02 2 mg

6- (2-carboxy-6-hydroxy-4-methylphenoxy) -3- (1-hydroxy-3-methylbutyl) -2-methoxybenzoic acid

Sign In for Pricing
View Details