Recombinant Bovine Protein YIPF5 (YIPF5)
This Recombinant Bovine Protein YIPF5 (YIPF5) spans the amino acid sequence from region 1-257.
Product Specifications
Product Name Alternative
Protein YIPF5, YIP1 family member 5
UniProt
Q5E9E8
Expression Region
1-257
Origin
Bos taurus (Bovine)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSGFDNLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSHQGRFVPADMMQPQQ PYTGQIFQPTQTYTPTTPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6364812-01 0.2 mL
ZC3H15, CT (ZC3H15, DFRP1, LEREPO4, Zinc finger CCCH domain-containing protein 15, DRG family-regulatory protein 1, Likely ortholog of mouse immediate early response erythropoietin 4) (FITC)
Sign In for Pricing
View Details MBS6364812-02 5x 0.2 mL
ZC3H15, CT (ZC3H15, DFRP1, LEREPO4, Zinc finger CCCH domain-containing protein 15, DRG family-regulatory protein 1, Likely ortholog of mouse immediate early response erythropoietin 4) (FITC)
Sign In for Pricing
View Details 
K7565208 1.0 µg DNA
Vstm4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details