Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein YIPF5 (YIPF5)

This Recombinant Bovine Protein YIPF5 (YIPF5) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein YIPF5, YIP1 family member 5

UniProt

Q5E9E8

Expression Region

1-257

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFDNLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSHQGRFVPADMMQPQQ PYTGQIFQPTQTYTPTTPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLE 1 (TLE1) (NM_005077) Human Recombinant Protein
E45H40017M5 20 µg

TLE 1 (TLE1) (NM_005077) Human Recombinant Protein

Sign In for Pricing
View Details
BDH2 Protein Lysate (Mouse) with C-HA Tag
13270035 100 µg

BDH2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
NPAS2 Antibody, Biotin conjugated
A66527-50UG 50 µg

NPAS2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SHISA7 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
43720156 3x 1.0 µg DNA

SHISA7 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
RGD1311805 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV643833 1.0 µg DNA

RGD1311805 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
RGD1560994 3'UTR Luciferase Stable Cell Line
TU218314 1.0 mL

RGD1560994 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details