Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q67TC3

Expression Region

1-257

Origin

Symbiobacterium thermophilum

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTFLFSLAEASGGKEFHIHQPFPVLLQGTYFEINNMIITQWLIVAGLLALAFVINRAVL SGRPSKLRGSLELLIDFLEGWFASFIGSRQYARQYMPLLCTLFLFIIVSNYLGVVPTVGY GLFAPTGRWGTTLGLGIVVAIAVQVIAIRTLGAGGWLKHILHLGPLSLLEEIVHPFSLSL RLFGNIFGEETLLAVIIFLAPMIAPIPIMVLSLVFGALQAVVFTTLTAIYIGAVLEHHQA HAHHPEGEAEHEPAPAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-EL-M3046-01 24 Tests

Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details
Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-EL-M3046-02 48 Tests

Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details
Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-EL-M3046-03 96 Tests

Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details
Human TTC17 activation kit by CRISPRa
GA110947 1 Kit

Human TTC17 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TMEM216 activation kit by CRISPRa
GA109684 1 Kit

Human TMEM216 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), 0.2mg/mL
BNUB2730-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), 0.2mg/mL

Sign In for Pricing
View Details