Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q67TC3

Expression Region

1-257

Origin

Symbiobacterium thermophilum

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTFLFSLAEASGGKEFHIHQPFPVLLQGTYFEINNMIITQWLIVAGLLALAFVINRAVL SGRPSKLRGSLELLIDFLEGWFASFIGSRQYARQYMPLLCTLFLFIIVSNYLGVVPTVGY GLFAPTGRWGTTLGLGIVVAIAVQVIAIRTLGAGGWLKHILHLGPLSLLEEIVHPFSLSL RLFGNIFGEETLLAVIIFLAPMIAPIPIMVLSLVFGALQAVVFTTLTAIYIGAVLEHHQA HAHHPEGEAEHEPAPAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Esm1 (BC020038) Mouse Tagged ORF Clone
MG201703 10 µg

Esm1 (BC020038) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MRas Recombinant Rabbit Monoclonal Antibody [JE64-57]
HA722579 100 µL

MRas Recombinant Rabbit Monoclonal Antibody [JE64-57]

Sign In for Pricing
View Details
Spta1 Mouse Gene Knockout Kit (CRISPR)
KN516680 1 Kit

Spta1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR85 (NM_001146265) Human Over-expression Lysate
LC431877 20 µg

GPR85 (NM_001146265) Human Over-expression Lysate

Sign In for Pricing
View Details
FKLF / KLF11 (KLF11) (NM_001177716) Human Over-expression Lysate
LC433174 20 µg

FKLF / KLF11 (KLF11) (NM_001177716) Human Over-expression Lysate

Sign In for Pricing
View Details
Dihydroxy Melphatalan
TRC-D452895-25MG 25 mg

Dihydroxy Melphatalan

Sign In for Pricing
View Details