Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein YIPF5 (yipf5)

This Recombinant Danio rerio Protein YIPF5 (yipf5) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein YIPF5, YIP1 family member 5

UniProt

Q6P5I8

Expression Region

1-257

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFDNFNTDFYQSSYSVDDQNQGGYGYSNTDEPYKPYGQYDYSQPMGYSAAPGMMQPQQ PYTGQIYQPTPAFTPTSSQSMYSSSFEDEPPLLEELGINFDHIWQKTLTVLHPLKASDGS IMNETDLAGPMVFCLAFGATLLLTGKIQFGYVYGISAIGCLGMYCLLNLMSMTGVSFGCV ASVLGYCLLPMIILSSFGVIFSLQGIMGIILTAAIIGWCSLSASKIFISALAMDGQQLLV AYPCALLYGVFALISVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAR2B Peptide
AF7867-BP 1 mg

NMDAR2B Peptide

Sign In for Pricing
View Details
IFNA1/Interferon alpha-D Human Monoclonal Antibody
orb2960411-01 100 µg

IFNA1/Interferon alpha-D Human Monoclonal Antibody

Sign In for Pricing
View Details
IFNA1/Interferon alpha-D Human Monoclonal Antibody
orb2960411-02 1 mg

IFNA1/Interferon alpha-D Human Monoclonal Antibody

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein B (S100B) Protein
abx682022-01 10 µg

Human S100 Calcium Binding Protein B (S100B) Protein

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein B (S100B) Protein
abx682022-02 100 µg

Human S100 Calcium Binding Protein B (S100B) Protein

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein B (S100B) Protein
abx682022-03 1 mg

Human S100 Calcium Binding Protein B (S100B) Protein

Sign In for Pricing
View Details