Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein YIPF5 (YIPF5)

This Recombinant Human Protein YIPF5 (YIPF5) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, SMAP-5, YIP1 family member 5

UniProt

Q969M3

Expression Region

1-257

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQ PYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF-alpha (Tumor Necrosis Factor alpha) (TNF/1500R), Biotin conjugate, 0.1mg/mL
BNCB1500-500 1x 500 µL

TNF-alpha (Tumor Necrosis Factor alpha) (TNF/1500R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)
MBS1330543-01 0.02 mg (E-Coli)

Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details
Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)
MBS1330543-02 0.1 mg (E-Coli)

Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details
Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)
MBS1330543-03 0.02 mg (Yeast)

Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details
Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)
MBS1330543-04 0.1 mg (Yeast)

Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details
Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)
MBS1330543-05 0.02 mg (Baculovirus)

Recombinant Burkholderia sp. ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details