Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uroplakin-1a (Upk1a)

This Recombinant Mouse Uroplakin-1a (Upk1a) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Uroplakin-1a, UP1a, Uroplakin Ia, UPIa, UPKa

UniProt

Q9D132

Expression Region

1-257

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAATEGEKGSPVVVGLLVVGNIIILLSGLALFAETVWVTADQYRVYPLMGVSGKDDVF AGAWIAIFCGFSFFVVASFGVGAALCRRRYMILTYLLLMLIVYIFECASCITSYTHRDYM VSNPSLITKQMLTYYSADTDQGQELTRLWDRIMIEQECCGTSGPMDWVNYTSAFRAATPE VVFPWPPLCCRRTGNFIPINEDGCRVGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAIL MWTLPVMLIAMYFYTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MADCAM1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H1]
TA506925BM 100 µL

MADCAM1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H1]

Sign In for Pricing
View Details
AMMECR1 (NM_015365) Human Recombinant Protein
TP312378 20 µg

AMMECR1 (NM_015365) Human Recombinant Protein

Sign In for Pricing
View Details
COX19 (NM_001031617) Human Over-expression Lysate
LC422214 20 µg

COX19 (NM_001031617) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin T1 (CCNT1) Human Gene Knockout Kit (CRISPR)
KN417377 1 Kit

Cyclin T1 (CCNT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEPE (N-term) Rabbit Polyclonal Antibody
AP52667PU-N 400 µL

MEPE (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
INSM1 Antibody
OC-389-01 50 μL

INSM1 Antibody

Sign In for Pricing
View Details