Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uroplakin-1a (Upk1a)

This Recombinant Mouse Uroplakin-1a (Upk1a) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Uroplakin-1a, UP1a, Uroplakin Ia, UPIa, UPKa

UniProt

Q9D132

Expression Region

1-257

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAATEGEKGSPVVVGLLVVGNIIILLSGLALFAETVWVTADQYRVYPLMGVSGKDDVF AGAWIAIFCGFSFFVVASFGVGAALCRRRYMILTYLLLMLIVYIFECASCITSYTHRDYM VSNPSLITKQMLTYYSADTDQGQELTRLWDRIMIEQECCGTSGPMDWVNYTSAFRAATPE VVFPWPPLCCRRTGNFIPINEDGCRVGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAIL MWTLPVMLIAMYFYTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF647 conjugate, 0.1mg/mL
BNC472984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Fluoro-2-nitrobenzotrifluoride
TRC-F594600-5G 5 g

5-Fluoro-2-nitrobenzotrifluoride

Sign In for Pricing
View Details
(Z)-Desbutyl Lumefantrine
TRC-D289345-25MG 25 mg

(Z)-Desbutyl Lumefantrine

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4) (TCF4/1705), CF740 conjugate, 0.1mg/mL
BNC741705-100 1x 100 µL

TCF4 (Transcription Factor 4) (TCF4/1705), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P55;50 EBV-Early Antigen (1108-1), CF405S conjugate, 0.1mg/mL
BNC040103-500 1x 500 µL

P55;50 EBV-Early Antigen (1108-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL36 alpha (IL36A) (NM_014440) Human Recombinant Protein
TP319328M 100 µg

IL36 alpha (IL36A) (NM_014440) Human Recombinant Protein

Sign In for Pricing
View Details