Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uroplakin-1a (Upk1a)

This Recombinant Mouse Uroplakin-1a (Upk1a) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Uroplakin-1a, UP1a, Uroplakin Ia, UPIa, UPKa

UniProt

Q9D132

Expression Region

1-257

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAATEGEKGSPVVVGLLVVGNIIILLSGLALFAETVWVTADQYRVYPLMGVSGKDDVF AGAWIAIFCGFSFFVVASFGVGAALCRRRYMILTYLLLMLIVYIFECASCITSYTHRDYM VSNPSLITKQMLTYYSADTDQGQELTRLWDRIMIEQECCGTSGPMDWVNYTSAFRAATPE VVFPWPPLCCRRTGNFIPINEDGCRVGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAIL MWTLPVMLIAMYFYTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COQ5 activation kit by CRISPRa
GA113471 1 Kit

Human COQ5 activation kit by CRISPRa

Sign In for Pricing
View Details
RAX Mouse Monoclonal Antibody [Clone ID: OTI5C10]
CF811005 100 µg

RAX Mouse Monoclonal Antibody [Clone ID: OTI5C10]

Sign In for Pricing
View Details
ELF5 Human qPCR Primer Pair (NM_198381)
HP230537 200 Reactions

ELF5 Human qPCR Primer Pair (NM_198381)

Sign In for Pricing
View Details
GNA14 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E8]
TA812023BM 100 µL

GNA14 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E8]

Sign In for Pricing
View Details
SH3 containing Grb 2 like 1 protein (SH3GL1) Human Gene Knockout Kit (CRISPR)
KN401552 1 Kit

SH3 containing Grb 2 like 1 protein (SH3GL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human LYPD5 activation kit by CRISPRa
GA117126 1 Kit

Human LYPD5 activation kit by CRISPRa

Sign In for Pricing
View Details