Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein YIPF5 (Yipf5)

This Recombinant Mouse Protein YIPF5 (Yipf5) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein YIPF5, YIP1 family member 5, YPT-interacting protein 1 A

UniProt

Q9EQQ2

Expression Region

1-257

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYSQQGRFVPPDMMQPQQ TYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIWQKTLTVLHPLRAADGS IMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFSASKIFISALAMDGQQLLV AYPCALLYGVFALISVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Protein NDRG2 NDRG2 Antibody Picoband® Fluoro594 Conjugated
PA2148-Fluoro594 100 µg/Vial

Anti-Protein NDRG2 NDRG2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
NR1, phosphorylated (Ser897) (N-methyl-D-aspartate Receptor subunit NR1, GRIN1, NMDA1, NMDAR1, NMD-R1, Glutamate receptor ionotropic N-methyl D-aspartate 1) (APC)
N5380-11-APC 100 µL

NR1, phosphorylated (Ser897) (N-methyl-D-aspartate Receptor subunit NR1, GRIN1, NMDA1, NMDAR1, NMD-R1, Glutamate receptor ionotropic N-methyl D-aspartate 1) (APC)

Sign In for Pricing
View Details
Cyclo (his-pro) (TFA)
HY-101402A-01 10 mM - 1 mL

Cyclo (his-pro) (TFA)

Sign In for Pricing
View Details
Cyclo (his-pro) (TFA)
HY-101402A-02 5 mg

Cyclo (his-pro) (TFA)

Sign In for Pricing
View Details
Cyclo (his-pro) (TFA)
HY-101402A-03 10 mg

Cyclo (his-pro) (TFA)

Sign In for Pricing
View Details
BAD
398360-01 50 µL

BAD

Sign In for Pricing
View Details