Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Uroplakin-1a (UPK1A)

This Recombinant Bovine Uroplakin-1a (UPK1A) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Uroplakin-1a, UP1a, Uroplakin Ia, UPIa

UniProt

P38572

Expression Region

1-258

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAAAATTEKGSPVVVGLLVMGNIIILLSGLALFAETVWVTADQYRIYPLMGVSGKDDV FAGAWIAIFCGFSFFVVASFGVGAALCRRRSMILTYLILMLIIYIFECASCITSYTHRDY MVSNPSLITKQMLTFYSADSNQGRELTRLWDRIMIEQECCGTSGPMDWVNFTSAFRATTP EVVFPWPPLCCRRTGNFIPVNEEGCRLGHLDYLFTKGCFEHIGHAIDSYTWGISWFGFAI LMWTLPVMLIAMYFYTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF740 conjugate, 0.1mg/mL
BNC741958-500 1x 500 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details