Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uroplakin-1a (UPK1A)

This Recombinant Human Uroplakin-1a (UPK1A) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Uroplakin-1a, UP1a, Tetraspanin-21, Tspan-21, Uroplakin Ia, UPIa, UPKa

UniProt

O00322

Expression Region

1-258

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAAAAEAEKGSPVVVGLLVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDV FAGAWIAIFCGFSFFMVASFGVGAALCRRRSMVLTYLVLMLIVYIFECASCITSYTHRDY MVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATP EVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAI LMWTLPVMLIAMYFYTML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reg3b ORF Vector (Mouse) (pORF)
38797014 1.0 µg DNA

Reg3b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Pth2r Mouse shRNA Lentiviral Particle (Locus ID 213527)
TL517191V 500 µL Each

Pth2r Mouse shRNA Lentiviral Particle (Locus ID 213527)

Sign In for Pricing
View Details
NMT55 Recombinant Antibody
bsm-61934R-TR 20 µL

NMT55 Recombinant Antibody

Sign In for Pricing
View Details
2,3-Dichlorobenzoyl chloride
OR5179 5 g

2,3-Dichlorobenzoyl chloride

Sign In for Pricing
View Details
SLC8A3 Antibody
orb523246-01 50 μL

SLC8A3 Antibody

Sign In for Pricing
View Details
SLC8A3 Antibody
orb523246-02 100 µL

SLC8A3 Antibody

Sign In for Pricing
View Details