Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uroplakin-1a (UPK1A)

This Recombinant Human Uroplakin-1a (UPK1A) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Uroplakin-1a, UP1a, Tetraspanin-21, Tspan-21, Uroplakin Ia, UPIa, UPKa

UniProt

O00322

Expression Region

1-258

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAAAAEAEKGSPVVVGLLVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDV FAGAWIAIFCGFSFFMVASFGVGAALCRRRSMVLTYLVLMLIVYIFECASCITSYTHRDY MVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATP EVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAI LMWTLPVMLIAMYFYTML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS20P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2040105 3x 1.0 µg

RPS20P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
FAM83D Human Gene Knockout Kit (CRISPR)
KN416954 1 Kit

FAM83D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Neratinib Impurity 46
RM-N051846-01 10 mg

Neratinib Impurity 46

Sign In for Pricing
View Details
Neratinib Impurity 46
RM-N051846-02 25 mg

Neratinib Impurity 46

Sign In for Pricing
View Details
Neratinib Impurity 46
RM-N051846-03 50 mg

Neratinib Impurity 46

Sign In for Pricing
View Details
Neratinib Impurity 46
RM-N051846-04 100 mg

Neratinib Impurity 46

Sign In for Pricing
View Details